Product Added to your Cart
x

-------- OR --------

English
FranceGermany
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Exclusive Blend
2 product(s) found for "Exclusive Blend"
Exclusive Blend Fruit Frenzy..
Exclusive Blend
Exclusive Blend Fruit Frenzy..
Description Worldwide known classic flavours that enhance the attraction of any bait, ideal for use in boilie mixes or stick, method mixes and ground baits. Highly concentrated for maximum quality, wide...
£13.69
Units in Stock: 1
£13.69
Details
Add To Cart
Description Worldwide known classic flavours that enhance the attraction of any bait, ideal for use in boilie mixes or stick, method mixes and ground baits. Highly concentrated for maximum quality, wide...
Exclusive Blend Nouvelle Fiz..
Exclusive Blend
Exclusive Blend Nouvelle Fiz..
Description Worldwide known classic flavours that enhance the attraction of any bait, ideal for use in boilie mixes or stick, method mixes and ground baits. Highly concentrated for maximum quality, wide...
£12.99
Units in Stock: 2
£12.99
Details
Add To Cart
Description Worldwide known classic flavours that enhance the attraction of any bait, ideal for use in boilie mixes or stick, method mixes and ground baits. Highly concentrated for maximum quality, wide...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i